PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009076.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 526aa    MW: 56113.8 Da    PI: 8.0492
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009076.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-39145205262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rn+PvG+grrk+k+ss
  Do009076.1 145 PDKILPCPRCNSMDTKFCYYNNYNIKQPRHFCKSCQRYWTAGGSMRNIPVGAGRRKSKSSS 205
                 7899*****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30142202IPR003851Zinc finger, Dof-type
PfamPF027013.8E-32147203IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.509149203IPR003851Zinc finger, Dof-type
PROSITE patternPS013610151187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MELAGAASPR SPESHVAPPR PPPHPPEKEK VTAFIFQAYL QFSNTCNCSA IDELVRSRIS  60
VLLPLFFSKK FANSPDTGDM KTTGEKPCTH QELDIGQTNS SSLNSSSECE NQPPSNDEMT  120
GSESNLETAK TKGDVPIGEK VLKKPDKILP CPRCNSMDTK FCYYNNYNIK QPRHFCKSCQ  180
RYWTAGGSMR NIPVGAGRRK SKSSSANCRS ILIPGSSVAT AVGEASLFPL SINGNQAAVN  240
FGTDSPLCNS MASVLKIGGE QSKNANPAST AQPRNGETQT CSPSTTTSDA PRSESHKGTV  300
SAHQNGVVGH GNGVTSMHPI PFFPGPPFVY PWSPAWNGIP AMAAPVSPAP AEAANYSENG  360
NSSSNVQWNV PPMVPVLPPG FCGPPIPVPV MPPSVWPFIT PWPNGAWSTP WLGAGSSVSA  420
SSPTSSSTCS DSGSPVLGKH SRDSRPQGDE KAERCLWIPK TLRIDDPDEA AKSSIWTTLG  480
IEPGERGMFR PFQSKPESRE QISSSAKVLQ ANPAALSRSQ SFQETT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958725.10.0PREDICTED: cyclic dof factor 3
TrEMBLK3ZSU30.0K3ZSU3_SETIT; Uncharacterized protein
STRINGSi029673m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-45cycling DOF factor 2